Internet Job Sites

10. Networking, Mentoring, & Q&A Sites

CyberFiber® Newsgroups Directory and Search

Your Recommended Allowance of Net News™
1

Job Newsgroup for Job Opportunity, Descriptions, Computer Job Openings, Recruiters, and Career Planning at JobBankUSA.com

Jobs Usenet Newsgroups2

Usenet Info Center Launch Pad

Usenet Info Center Launch Pad3

Monster: Message Boards

Monster Message Boards

Welcome to the Monster message boards. Our experts answer posts approximately twice a week. Feel free to ask questions, share your stories and network with your peers.

4

Vault: Message Boards

Welcome to the Electronic Watercooler™ – the original online workplace and career community.
We have 846,886 messages to read.
5

A Better Job Fast! - myjobsearch.com

 

 
The myjobsearch.com free monthly newsletter.
Sign up now!
 
Effective networking is much more than asking people you know about job opportunities. To be successful, you need to get to know more people. The following resources will help you meet people in your field and network with them successfully.
6

WetFeet.com > Managing Your Career > Networking

Networking7

Monster: career management: Networking

Networking
8

Quintessential Careers: The Art of Networking

The Art of Networking9

SchmoozeMonger.com the Networking and Schmoozing Uberportal

Subscribe to the Schmoozeletter! Send a blank email to mailto:schmoozemonger-subscribe@yahoogroups.com .10

Business Networking Articles by Susan RoAne

Business Networking, Conversation, and Mingling Articles

11

Contacts Count - Working Know-How for Business and Career Success

Want lots of useful tips on networking and career futuring?

12

Amazon.com: Books: America's Top Internet Job Sites: The Click and Easy Guide to Finding a Job Online (Click & Easy Series)

America's Top Internet Job Sites: The Click and Easy Guide to Finding a Job Online (Click & Easy Series)
by Ron Krannich, Caryl R. Krannich, Ronald L. Krannich

c2002

November 25, 2002

Chapter 1
4. being effective and staying focused
7. - assessment; research; networking; resume & letters; interview; salary negotiation

Chapter2: Getting Started & Staying Focused
11. using time wisely
13. N.B. roughguides.com ...
14. goettem.com
15. cf: search engines; search agents; directories
39. Bolles, Margaret F. Dikel; Randall Hanson
59. advocates redundancy ...
61. hoovers.com & wetfeet.com; monster owns -> hotjobs.com; jobtrack
63. jobs.com reference checker
69. vault.com
89. self directed search
107. Harcourt <- Thomson Learning
108. Brainbench
124. declining companies13

1. The World of Internet Job Sites

2: Getting Started and Staying Focused

Top9.com

http://www.top9.com/

Top9.com is the Internet's first Search Directory to use consumer intelligence to comprehensively rank the most popular websites by industry category on a monthly basis. Top9.com will change how consumers look for information and products on the Internet - no more wading through useless clutter and broken links. And its simple design will allow consumers to easily surf using PCs, hand-held devices, and WebTV. Top9.com is more than just another online search directory - it is a tool to empower consumers to make smart decisions.

Top9.com is a new business venture of Omega World Travel, which has signed a five-year agreement with PC Data Online for exclusive rights to consumer research intelligence for Top9.com. PC Data Online surveys "unique users" from a panel of over 120,000 real-time home users of the Internet - the largest domestic home panel of any Internet measurement firm. Because of the size of the survey pool, and the independent methodology used by PC Data Online, Top9.com's rankings are based on the most reliable Internet consumer research data available today.

14

Ranks.com - Top Job Search Sites

Ranks.com : Lifestyle : Top Job Search Sites (60)

Ranks.com is a simple, effective upgrade from current search engines. The easy difference is that our directory queries only the best destinations available for your search, within categories that matter most. By using experienced human judgment each link is the best in its field, guaranteed by our staff of specialized directory editors.15

100Hot

100hottest jobs sites16

3: Virtual Job and Career Communities

Google

Google 17

CyberFiber® Newsgroups Directory and Search

LC&D Internet Publishing is pleased to present CyberFiber® Newsgroups,
the most comprehensive directory to USENET and alt. Newsgroups.
18

Job Bank USA

JobBankUSA.com19

Topica

Topica 20

4: Gateway Employment Sites

Quintessential Careers Site Award: myjobsearch.com

myjobsearch.com21

AIRS

AIRS22

CAREERXROADS - the leading guide to job and resume sites on the Web

CareerXroads 23

Quintessential Careers: College, Careers, and Jobs Guide

Quintessential Careers 24

The Riley Guide: Employment Opportunities and Job Resources on the Internet

The Riley Guide25

JobHuntersBible.com: Job Hunting Online with Richard Bolles and What Color Is Your Parachute

JobHuntersBible 26

Job-Hunt.Org, Award-Winning Jobs and Job Search Super-List, Careers, Employment, Job Site Directory

The Super-List of the Web's best Careers, Jobs, and Job Search Sites.
27

Career Resource Homepage

The sites containing career related resources have been categorized as follows: 28

Jobweb - The Catapult

Jobweb's Catapult, the springboard to career- and job-related sites, will soon disappear from our site. The information, however, has been added into the new JobWeb structure. We have kept the original table contents on our site to help you find the information you are seeking. If you refer to one of the pages below frequently, please delete your existing bookmark, and create a new one today. 29

Jobs, Careers, Employment, Education, Business Links - Careers.Org

Careers.Org
IF IT'S ABOUT YOUR CAREER ... IT'S HERE !!!
30

JobSourceNetwork-The Internet's Mega Job Site!

We at the Job Source Network have helped thousands with their job search -
and we want to help you.

31

University of London Careers Service

[University of London Careers Service Home] 32

JobBoard.net

We have searched the Internet for Job Boards and Resume Banks and brought all these links together at one convenient location!

33

MegaJobSites.com : Job Search

MegaJobSites® The largest community of job sites online.
Please visit the niche site that best matches you and your profession!
34

5: Mega Employment Sites and Databases

Monster

Monster 35

America's Job Bank - job search engine - Jobs

Welcome to America's Job Bank!
Visit our site and see how we can help you find the job that's right for you. Thousands of new jobs are posted daily by employers searching for someone like you.
36

FlipDog.com

FlipDog.com 37

JobsOnline

As one of the leading employment websites on the internet today, JobsOnline provides job seekers with extensive job listings and the most useful career resources to begin a successful job search. Thousands of jobs, resume and cover letter samples, expert career advice, and a handy salary calculator are just a few offerings that are free to those seeking a new job.

38

HotJobs.com

HotJobs 39

careerbuilder.com

CareerBuilder 40

Headhunter.net (Careerbuilder.com?)

CareerBuilder 41

Jobs.com
Whether you're just starting your career or looking to strengthen your lead in the business world, these sites offer the most comprehensive career resources available on the Web.

Go find the job that's right for you from over 1 million job listings or post your resume and let the world's top employers come discover you. 42

JobOptions -Job Database, Private Resume Builder and Recruitment Resource

Job Options is pleased to introduce Spherion. Serving as your personal recruiter, Spherion can help you identify companies that meet your criteria, and is seeking qualified candidates with your skills.43

Career.com

CAREER.COM P.O. Box 3536, Los Altos, CA 94024-3536
Voice: 650.851.1580 Fax: 650.851.7340
E-Mail:info@career.com
44

MSN Search: www.myjobsearch.com -- More Useful Everyday

We can't find "www.myjobsearch.com".

45

employMAX employ jobs resumes

Job Seeker
46

NationJob

Job Seekers
Search Jobs & Sign Up P.J. Scout
Search Companies
Access Your P.J. Scout Account
Post Your Resume with P.J. Scout
47

EmploymentGuide.com

Search or browse jobs in your city
or across the nation48

CareerJournal.com -- The premier executive career site from The Wall Street Journal
Employment 911 - Job Search, Resume Posting, Job Posting, Career & Employment Advice and Human Resources Tools

Why spend hours going from one job site to another?
You can use Employment 911 to search over 100 major job sites and 3 million jobs in only one click. Our job search covers more job sites at one time than anyone else. 50

EmploymentSpot.com: Job search, careers, jobs, employment, resumes & more.

© 1998-2002, StartSpot Mediaworks, Inc.
Advertising Information | Privacy Policy | Contact Us
51

JobFactory.com - Search millions of jobs, plus locate career information, joblines, and recruiters...



A Summary of What You Will Find   The JobFactory provides online help for the jobseeker in the following areas...

52

Vault: the insider career network

"Vault" is a registered servicemark and "Vault.com", the "Vault.com logo", "Electronic Watercooler", "The Workplace Network", "Am I Worthy", "Tools for Work", "VaultMatch", "The HR Guy", "The Insider Career Network", and "Career Advancement for Professionals" are trademarks and/or service marks of Vault.com Inc. All other products, company names or logos are trademarks and/or service marks of their respective owners.53

WetFeet.com > Helping You Make Smarter Career Decisions

Even more updated insider information to help you land the job.
54

Net-Temps - The Leading Website for Contract, Temporary and Permanent Employment

Copyright 2002, Net-Temps, Inc. All Rights Reserved. Net-Temps ® is a registered trademark.55

4Work Home Page

Job Alert! is a confidential job search agent that screens thousands of jobs to find situations suited to you. Get results in two minutes with fresh updates emailed daily! Login or sign up today...It's free! 56

BestJobsUSA.com - For your job and your career

BestJobsUSA.com
550 Heritage Drive, Suite 200
Jupiter, FL 33458
Phone - 561.686.6800 | Fax - 561.686.8043
rci@bestjobsusa.com57

BrilliantPeople.com - The Jobs. The Recruiters. The Good Life.

Copyright © 1999 - 2001 Management Recruiters International, Inc.
ALL RIGHTS RESERVED
58

CareerShop_Home

   Screen resumes and post jobs with your online career center and hiring system.
   Click here to find out more!

59

MSN Search: www.jobsleuth.com -- More Useful Everyday

We can't find "www.jobsleuth.com".60

TrueCareers.com (Career City)

Sweepstakes | Privacy | Terms of Use | About TrueCareers, Inc. | Posting Jobs
©2001-2002 TrueCareers Inc. All rights reserved. | 1.800.441.406261

JobWeb.com - The online complement to NACE's Job Choices publications.

Every week JobWeb’s editorial team scours the headlines to find what matters most to college students and new grads—and we put it right here!62

monsterTRAK

Avoid weeding yourself out of a job match. Write clear, clean resumes and letters. 63

JobOpps.net

Cannot connect.

BrassRing.com: IT and high tech job search & HR software

BrassRing.com is the job search site for finding IT jobs, tech jobs, Internet jobs, and job fair information. Using BrassRing's job database, candidates can post resumes to high tech employers and find employment opportunities.
64

Job Bank USA

Welcome to JobBankUSA.com! 65

CareerTV.net - It All Starts Here

© 2000 CareerTV.net, Inc. All rights reserved.
Questions or comments? Send mail to webmaster@careertv.net
66

Jumbo Classified Careers -- Jobs, Careers, Resumes, Employment and More!

Consultants:
Jumbo Classifieds Networking has more than 70,000 computer related brand name low cost items. All shipping is FREE! This includes NEXT-DAY delivery. Please be sure to stop by Jumbo Classifieds Networking for all your computer needs. 67

Preferred Jobs - Computer Jobs - Atlanta Denver Florida Chicago Boston California

© 1997 American Preferred Jobs Inc., All Rights Reserved. Legal & Privacy Notices 68

ProHire | The Leader in Online Job Searching and Recruiting Solutions has Jobs and Employment for Professionals - Resume Banks, Employment Resources, Job Placement

powered by Recruitmax Software | the leader in online recruiting solutions 69

CareerExchange.com | Thousands of jobs!

Let CareerExchange.com email you matching jobs!70

CareerMag Career Center

Get started right now by creating your Free account and take advantage of all the tools that come with it. You can post your resume, build your portfolio, turn it into a personal website all in a matter of minutes. Search jobs and submit your resume directly to the companies that interest you. Take a few moments and create your Free account now!
71

EmployersOnline - Jobs - $45K to well over 6 Figures

Search our job database for job opportunities! 72

Wanted Jobs - United States

Copyright © 2002, Wanted Technologies Inc. All Rights Reserved.73

mindfind.com - Looking for something?

Welcome to mindfind.com. We've collected a list of resource sites to help you find exactly what you're looking for. Find what you're looking for below or use the search box on the left. Thanks for visiting and we hope you we've made your internet experience a little better.74

Employment Wizard (JobExchange)

Will Your Résumé Pass the 30-Second Test?     Did you know that most recruiters make a decision on your
résumé in only 30 seconds! Let an expert give you an edge!
75

RecruitUSA: Recruitment Optimization

Is there anybody out there?

Yes. And they're looking for you right now.

Launch your career search by accessing thousands of jobs, and add your resume to our resume database.

76

JobDirect (TrueCareers.com)

Sweepstakes | Privacy | Terms of Use | About TrueCareers, Inc. | Posting Jobs
©2001-2002 TrueCareers Inc. All rights reserved. | 1.800.441.406277

Other major sites

1-jobs.com: BrassRing.com: IT and high tech job search & HR software

BrassRing.com is the job search site for finding IT jobs, tech jobs, Internet jobs, and job fair information. Using BrassRing's job database, candidates can post resumes to high tech employers and find employment opportunities78

6FigureJobs - the leading site for executive job seekers, employers and executive recruiters

Search through over 4.5 million job postings from over 6,000 sites across the Web.79

Advance Careers: Best Local Jobs

Best Local Jobs Is A
Service of Advance Internet

80

CampusCareerCenter.com - Entry-Level Jobs & Internships for College Students

CampusCareerCenter.com – Entry-Level Jobs & Internships for College Students © 2002 All Rights Reserved. 81

CareerMarketplace.com Engineering, IT, Marketing and Related Job Sites

N.B. Has many field related web sites

 

© 2002 Critical Mass Systems. Critical Mass Systems, www.CareerMarketplace.com and other listed domain names are trademarks of Critical Mass Systems. 82

CareerSite.com - Post your resume and find great jobs! FREE TRIAL-for employers!

Copyright © 2002 CareerSite Corporation. All rights reserved. 83

Classifieds2000.com - The Ultimate Guide

Formerly Excite Classifieds
84

College Recruiter: Jobs Internships Work Entry Level Careers Students Search Resume Bank Database

Copyright © 1996-2002. All rights reserved.
Adguide Publications, Inc. - 3722 W 50 St Ste 121 - Minneapolis, MN 55410-2016
(800) 835-4989 | (952) 848-2211 | Fax: (952) 915-1102 | Email
85

ComputerJobs.com - Computer Job Search for IT Pros

Copyright 1995-2002 © ComputerJobs.com, Inc. All Rights Reserved.
ComputerJobs.com is a registered trademark of ComputerJobs.com, Inc.
86

craigslist: san francisco bay area online community

craigslist
87

Dice.com

4101 NW Urbandale Drive, Urbandale, IA 50322
Toll Free Phone: 877.386.3323 | Fax: 515.280.1452 | Local: 515.280.1144
88

Employment Wizard

Will Your Résumé Pass the 30-Second Test?     Did you know that most recruiters make a decision on your
résumé in only 30 seconds! Let an expert give you an ed
89

ExecuNet - The Center for Executive Careers

What sets us apart?

We're a unique executive community. The premier interactive network and membership organization for the $100,000+ executive. We focus exclusively on the job search and career advancement needs of our members and those seeking top executive talent.
90

Experience.com

Copyright ©2002 Experience.com, Inc., One Faneuil Hall Marketplace, Boston, MA 0210991

Free Community

Not informative site at all.  All it does is one giant mailto page.92

GotAJob.com is your complete job hunting resource site. Part time, full time, anytime!

GotAJob.com is your place whether you've already "Got-A-Job" or you're just starting your job search. If you are looking for a part-time job, visit our partner site, SnagAJob.com, where you'll find thousands of part-time jobs from some of the most well-known companies around the country.
93

HireAbility.com - Home

Copyright © 1997-2002 HireAbility.com, LLC     Phone 603.890.1099 94

Hirestrategy.com - Connecting Talented People with Great Places to Work

Security clearances have always been resume gems in Washington, but with the expected boom in homeland security jobs, a clearance has become as highly prized as a taxi medallion in Manhattan. 95

ITcareers

Despite the tough economy, keeping prized IT workers satisfied is still a top priority at companies in the U.S. and around the world. The best employers know how to do more with less while keeping their IT staffs content and challenged96

JobCircle.com: A regional tool that provides Careers, Content, and Community for technology professionals!

JobCircle.com is an award-winning employment and information tool for Technology professionals in Boston and surrounding areas. JobCircle.com provides thousands of regional employment opportunities, resume submission, career development, monthly columns, discussion databases, tech news, regional career events, and much, much more to a community of over 72,287 technology, telecom, engineering, and security-cleared professionals!  Read what people are saying about JobCircle.com! 97

Jobnet.com Philadelphia's Career Site

No time to search for a job? Jobnet understands. We can do it for you! Hire our Job Butler and he¹ll email the right jobs to you every week. The best part is that it's free!
98

JobStar: Job Search Guide

"How To" Information for Job Seekers Everywhere: Resumes, Career & Salary Info, Hidden Job Market. 99

800-241-5642 - NETSHARE.COM - Your source for executive jobs

Copyright © 2002 • NETSHARE.com • All rights reserved100

washingtonpost.com: Jobs

©Copyright 2002   The Washington Post Company
101

Welcome to / Bienvenue sur workopolis.com

102

6: Assessment and Testing Sites

MAPP- Brought to you by Assessment.com

MAPP reveals the real you
Your Assessment reveals your natural motivations and talent for work. When your job matches your true motivations work seems easier and is more fulfilling. 103

careerhub.org - Welcome

Careers
Work At Home, MBA, MCSE, Nursing, Education, Business Schools, Management Training, Online Training, Graduate Schools, Start A Business 104

Keirsey Temperament and Character Web Site

The Web Site for the Keirsey Temperament Sorter and Keirsey Temperament Theory
105

Personality Type Welcome - book headquarters for Do What You Are - Nurture By Nature - Just Your Type - The Art of Speedreading People

We're the authors of four best selling books about Personality Type -- a powerful tool that will make you happier and more successful in every aspect of your life. This site is all about YOU -- your career, your family, your children, your relationships! Knowing your "type" unlocks powerful insights that help you understand yourself and others as never before. 106

Personality Online - Online personality, relationship and apptitude tests, find out who you are today!

Welcome to Personality Online, your one stop resource for self discovery and personal development. Here you will find everything from a variety of personality tests to a comprehensive database of personal development related resources. 107

Welcome to the Self-Directed Search...the world's most widely used career interest inventory!

108

The Princeton Review Career Quiz

The Princeton Review Career Quiz

Think of how happy you'd be to go to work each day saying to yourself, "I want to," not "I have to." The difference? It's simply matching the right person with the right place. For most people achieving that perfect fit isn't that simple.

109

Analyze My Career: Aptitude tests, Personality test, Career Guidance, Employment data, Entrepreneur test

Copyright 2001 AnalyzeMyCareer.com. All rights reserved.
8345 NW 66th Street #3689, Miami, FL 33166-2626.   Voice/Fax: (305) 418-7402
110

Assessment MBTI Career Chart - U.S. DOI

Connecting Personality Types With
Careers and Jobs

111

CareerPerfect® premier résumé writing, online career planning, interviewing, testing ... and more!

- Career planning and testing for career success112

Personality and IQ Tests

Personality Tests 113

QueenDom.com: Tests, Tests, Tests: The world’s biggest testing center with personality, intelligence, relationship, career and health tests.

Tests Tests Tests
Are you worried about your ability to concentrate? Is your failure to focus on important tasks interfering with the achievement of your goals? Take Queendom’s new
Attention Test to find out just how much this is impacting on your life.
114

IQ tests & Personality tests

Personality tests, iq tests and entrepreneur tests online 115

Fortune.com - Careers

Holiday Job Hunting
Contrary to the conventional wisdom, November and December may actually be the best months to land a new position. Here's how to make the most of the season, career-wise. 116

Profiler: Your Expert in Internet Data Collection

Welcome to profiler.com. You can use this Internet site to collect data for a multitude of purposes. Some of the more popular applications are assessments/tests, satisfaction and demographic surveys, enrollment applications, product registration, and data and report distribution. We can develop electronic documents as elaborately as required including multimedia and data editing/verification. If you don't have a corporate Internet presence, want to outsource a project, or want to remain anonymous, profiler.com can be your solution.
117

CareerLab: 700-page career, outplacement, & HR megasite

We're a career strategy and leadership development firm based in Denver, Colorado USA. "We help people with their careers, and we help companies with their people."(sm) Since 1978, more than 275 brand-name corporations, both large and small, have hired us to guide them safely and effectively through major organizational change. At the same time, we've orchestrated remarkable career advancement for mid-to senior-level managers and executives, top professionals, consultants, and entrepreneurs. This page is updated for Thursday, December 12, 2002. Translate this site into your native language. 118

College Board: College Planning and Career Planning from MyRoad.com

©2002 by collegeboard.com Inc. and its licensors. All rights reserved.119

CareerLeader: Guided Tour

Welcome to the Guided Tour of the most respected and comprehensive business career development tool -- CareerLeader®. This program is a fully integrated approach to business career self-assessment developed by Dr. Timothy Butler, Director of MBA Career Development Programs at the Harvard Business School, and Dr. James Waldroop, Dr. Butler's associate at HBS for 18 years. This interactive, online program is currently being used by over 150 top business and MBA programs in the US and Europe to help guide their students, as well as by numerous corporations to help retain their employees.
120

Careers By Design Career Assessments

Careers By Design® is a professional career development site offering affordable, statistically reliable and valid  career and personality assessments for individuals and organizations. All assessments are available online with several personalized reports to choose from.  Prices include the cost of the assessment, resulting report and telephone counseling session.  Self-assessments without career counseling are also available. Additional professional services include Resume Writing and Outplacement Services for both individuals and corporate clients. 121

The Career Interests Game

Welcome to the Career Interests Game! This is a game designed to help you match your interests and skills with similar careers. It can help you begin thinking about how your personality will fit in with specific work environments and careers. Come play along and see what happens! For more information about the Career Interests Game, careers, majors, and self-assessments (the SDS, Discover, Choices and SIGI-PLUS), call or come by the Career Center. 122

The Career Key: Choosing a Career -- Career Guidance

The Career Key will help you in choosing a career, a college major; changing a career; and career planning. Thousands visit daily for free professional career help. Choose You , Us, Others to begin:
123

Korn/Ferry International

Futurestep, a Korn/Ferry International company, is a global leader in middle management recruitment. Drawing from Korn/Ferry’s more than 30 years of industry experience, Futurestep provides customized recruitment solutions to employers – and offers candidates access to exclusive job opportunities around the world.  124

GSIA: Career Opportunities Center

Overview

This material is essential reading for anyone beginning a job search, writing a resume, or planning to interview. Self-assessment is the cornerstone of career decision making! It will make your job search easier if you spend time on this chapter.

We suggest that you print out this form, find a quiet place or sit down with a friend and complete the following self-assessment exercise. This is one of the most important homework assignments you will complete at GSIA and one of the most difficult. The answers you select are not cast in concrete; they can and will change as you gather more information. To get where you are going, you have to know where you are and where you have been.

Review your answers to the value and skills exercises from orientation. Throughout your career your values and the skills you want to use will change, so reviewing them on a yearly basis is a good exercise. Career Discovery is another tool you can use to learn more about yourself.

  1. Describe yourself in one sentence:
  2. What are your greatest:
    • Abilities:
    • Skills:
    • Interests:
  3. What abilities, skills and interests do you want to cultivate?
  4. What really makes you who you are?
  5. What do you consider your major accomplishments?
    • At work:
    • At school:
    • In your personal life:<
  6. What challenges you the most?
  7. Are you a creative person? Analytical? Mechanical?
  8. Do you prefer working independently or as part of a team?
  9. Do you need structure, or are you comfortable setting your own pace?
  10. How much variety do you need?
  11. How important is stability to you?
  12. Which of your abilities do people most often praise? Which habits are most often criticized?
  13. How have you set yourself apart from the crowd?
  14. How do you handle long hours? Heavy pressure? Deadlines?
  15. How do you get along with others? Are you a natural leader? A team player?
  16. Are you an overachiever?
  17. What kinds of new experiences and people would you like to encounter in the future?
  18. What kind of image do you think you project? Want to project?
  19. What do you currently know about the following career areas?
    • Finance
    • Marketing
    • Consulting
    • Banking
    • Operations/Production/Manufacturing
    • Information Systems
    • Strategic Planning
  20. What are the 10 most important things you are looking for in a job (can include things like: travel, challenge, stability, 40 hour work weeks, benefits, etc.)
125

Interest Finder Quiz

Work Interest Quiz126

The Highlands Program

In 1990 we pioneered a distinct methodology called The Whole Person Technology®. People who participate in the assessments, in workshops based on this approach, achieve a remarkably consistent result: they experience an exceptionally high degree of satisfaction, meaning, productivity and success in their work and in their lives.
127

Jackson Vocational Interest Survey

There are over 36,729 possible careers in North America today, and over 284 academic majors. A few will make you very happy. The rest may leave you feeling unsatisfied and trapped. How will you find the one that is best for you? Taking a career test can help. Take the JVIS, and you'll be on your way to peace of mind….and a bright, rewarding future.

Take the JVIS Now

The JVIS is an educational and career planning tool. It provides a detailed snapshot of your interests and how they relate to the world of study and work. It will focus your search for professional and academic satisfaction. You'll have access to links, resources, and industry contacts to help you learn more about the careers and university majors that will help you make the most of your time and talent.128

Utne.com: Test Your Emotional IQ

Special to Utne Reader, Nov/Dec '95
Daniel Goleman

You've got the intellectual credentials: You did pretty well in school, maybe have a college diploma or even an advanced degree. You got high scores on your SATs and GREs, or even on that holy grail of the intellect, the IQ test. You may even be in Mensa, the select high-IQ club.

That's fine when it comes to intelligence of the academic variety. But how bright are you outside the classroom, when it comes to life's stickier moments? There you need other kinds of resourcefulness -- most especially emotional intelligence, a different way of being smart. 129

OnlineProfiles

Instant Feedback with Onlineprofiles !
Welcome to the onlineprofiles.com Site. You will find here practical resources to
assist you in your work and in your career.
130

Emode.com: Career Tests

131

HumanMetrics - Internet online relationships, personality and entrepreneur tests, personal solution center

HUMANMETRICS TRY YOUR TRAITS BEFORE TRYING FATE132

Personality Test

Personality Test
Click on the shape you find most appealing. Consider both form and color.
133

Inner Self Personality Test

Inner Self Personality Test

Based on 60 Multiple Choice Questions134

Contacting a Career Professional

NBCC

 









RACCCCECounselorFindmyNBCCNBCC Insurance

© NBCC, 2001  
135

NCDA

NCDA Awards Nominations for 2003
Do you have a colleague who has gone to great lengths to provide career counseling to individuals in your state, who has developed innovative programs to enhance career development, who has influenced legislation, or who has been a leader in your state or in NCDA? Please nominate that person to receive an NCDA award! The awards will be presented at the NCDA Conference in Denver, Colorado.
136

CPAD Network

The Career Planning & Adult Development Network keeps you in touch with other career counselors, career coaches, job search trainers and human resource professionals through its publications, workshops and conferences. The NETWORK publishes a bimonthly newsletter and quarterly journal, both free to NETWORK members. The NETWORK also conducts certification workshops for job and career transition coaches
& job search trainers.
137

Career Masters Institute

WELCOME TO THE CAREER MASTERS INSTITUTE
Career & Employment Industry’s First Global Training, Development &
Professional Networking Organization
138

PRWRA

The PRWRA empowers its global members
to utilize innovative and proactive resources
in their complete career development, résumé writing, and employment practices.139

7. Education and Online Learning Sites

University of Phoenix - Adult Education, Evening Classes, Degree Programs, Online Education, Bachelor Degrees, Night School

At University of Phoenix, you can earn your bachelor’s, master’s or doctoral degree any way you want to – on campus, online, or in certain areas using a combination of both, which we call FlexNet®. University of Phoenix has grown to be the nation’s largest private university, specializing in the education of working adults by offering degree programs that are highly relevant, accessible, and efficient. With over 100 campuses and learning centers in the United States, Puerto Rico, Canada and via the Internet, you can complete your degree no matter where you live, what hours you work, or how often you travel or relocate. 140

Online Programs - UMUC
Online Programs
University of Maryland University College has pioneered the next wave in access to education: online delivery.

Online education at UMUC offers educational opportunities unparalleled by any other university. With more than 20 complete degree programs available online (and more added each semester), UMUC students around the world can complete their degree without having to set foot in a classroom.

Online programs at University of Maryland University College are very user friendly, allowing the student to interact directly with instructors and coursemates through WebTycho, the university's own online delivery software.

If you would like to see how distance education works, visit our Orientation to Distance Education. If you'd like to see how UMUC delivers its online programs via WebTycho, take the Online Test Drive.
141

American Military University - Earn a Graduate or Undergraduate Degree Online.

American Military University is an accredited private institution of higher learning. Our distance learning system supports more than 10,000 students from all 50 states and many foreign countries. AMU is licensed by the West Virginia Higher Education Policy Commission and, as a member institution of the American Public University System, is nationally accredited by the Distance Education and Training Council.

Through its innovative and convenient online learning method, AMU offers a wide variety of undergraduate and graduate-level degree and certificate programs to students. Affiliation with the military is not a requirement for admission and many civilian students enroll in AMU programs. However, AMU is dedicated to providing quality education to the men and women of the Armed Forces. Many academic programs are designed to advance the careers of military personnel serving in a variety of professions and assignments.

All of AMU's programs are delivered through state-of-the-art online distance learning with no residency requirements. AMU's world-class faculty of more than 400 scholars has decades of relevant work experience and the highest levels of academic credentials.

142

Peterson's Education Portal – Colleges, Graduate Programs, Financial Aid

Learn...Anytime, Anywhere
Interested in earning your degree online? Get recruited by distance learning providers searching for applicants like you.143

America's Learning eXchange

careeronestopcareeronestopAJBAJBservicelocatorservicelocatoracinetacinet144

America's Job Bank - job search engine - Jobs

Welcome to America's Job Bank!
Visit our site and see how we can help you find the job that's right for you. Thousands of new jobs are posted daily by employers searching for someone like you.
145

Distance Learning on the Net - By Glenn Hoyle

Distance Learning on the Net celebrates 8 years of bringing descriptions of distance education web sites, along with links to lead you to further Distance Learning and education resources. 146

Distance Learning Course Finder
Welcome to the Galaxy of Distance Learning!

The International Distance Learning Course Finder is the world's largest online directory of e-learning courses from 130 countries. This universal distance education resource has information on over 55,000 distance learning courses and programs offered from a multitude of universities, colleges and companies.147

MindEdge

Copyright © 2001 MindEdge, Inc., All rights reserved.
148

The Distance Education and Training Council

Copyright © 2002 Distance Education and Training Council — All rights reserved.
149

Bears Guide

Bears' Guide to Earning Degrees
by Distance Learning
14th Edition
by John Bear, Ph.D., and Mariah Bear, M.A.

After 25 years and over 350,000 copies sold, this classic bestseller is still the resource for anyone looking to earn a degree in a nontraditional way—whether by distance learning, evening courses, credit for life experience, or guided independent study. 

  • Detailed information on over 2500 schools
  • Covers associate's, bachelor's, master's, and doctoral degrees, as well as law and medical studies
  • Tips on how to obtain credit for life experiences
  • The leading resource on degree mills and how to avoid them
  • 150

    Welcome to Capella University

    Capella University offers over 500 online courses, as well as undergraduate and graduate degree programs in 40 areas of specialization - all as close as your computer.
    151

    Kaplan Higher Education

    Copyright © 2002 Kaplan Higher Education. All rights reserved.
    Kaplan is a registered trademark of Kaplan, Inc.

    152

    Study at home with Education Direct Technical, Business, Computer, Career

    Welcome to Education Direct
     
    The at-home learning choice for millions of students worldwide.  
    Education Direct will start you on
    the road to more money and job satisfaction. We offer proven, flexible distance learning programs so you
    can learn at your own pace in the convenience of your own home.
    Think of it - you'll gain exciting new skills without giving up your current
    job or attending any classes.
     
    153

    Microsoft eLearn | Home

    Welcome to Microsoft eLearn


    Here you will find the latest information about online content and resources available today from Microsoft and our eLearning vendors. By providing the enabling technology, content, and services in eLearning—our goal is to enable anytime, anywhere access to information for knowledge workers. Whether you are an educator, trainer, solution provider, global company, or just interested in what Microsoft is doing in the area of eLearning—we have something for you.154

    Traditional Education Programs

    My College Guide

    How does the ACT compare to the SAT?  Does it really matter which test is taken? Answer >


    Attention Colleges: Interested in being listed in My College Guide? Contact Cynthia Klenke by e-mail.
    More than 150 tons of meteorite debris slams into the Earth each year.
    155

    College search, financial aid, and scholarships: CollegeView

    college search, college admissions, admissions, college, scholarship search, scholarships, scholarship, financial aid, universities, university, college application, application, minority scholarship, minority, hobsons, campus tours

    college search

    scholarships

    financial aid

    universities

    university

    minority

    hobsons

    campus tours

    college searchscholarship searchcollege admissionscollegeuniversitiesuniversityscholarshipsfinancial aiduniversity applicationhobsonscampus toursminorityapplicationadmissions




    Media Center  |  Contact Us  |  Site Map  |  Privacy Statement  |  Help  |  Feedback












    156

    Career Explorer: Map Search for schools across the country






    Win money for school!
    Click here to enter the Career Explorer Scholarship Contest!
    AKIAHIHIHIHIHIHIHIHIPRPRPRPRCANMTNVCAORWAIDWYUTAZTXSDMIWIMIMNNDNECONMOKKSMOTNARMSLAFLALGASCILINKYNCVACTRIMAOHWVMDDENJPANYMDDENJCTRIMAVTNHVTNHME
    Career: Careers | Aptitude Test| Articles | Job Search Schools: Map Search| Courses | Articles Financial Aid: Scholarships | Articles | Links Resources: FAQ | Survey | Articles | Links Contact Us: Contact Info | Add your school | Advertise







    157

    Useful Associations & Companies

    ADEC Distance Education Consortium


























     

    The American Distance Education Consortium

    ADEC National Excellence in Distance Education Excellence Award Winners - Link to Great Plains IDEA, the 2002 Excellence Award WinnerLink to University of Kentucky, the 2000 Excellence Award WinnerLink to Cornell University, the 2001 Excellence Award WinnerLink to Great Plains IDEA, the 2002 Excellence Award Winner
    2000 University of Kentucky   2001 Cornell University   2002 Great Plains IDEA


     
     
     
    158

    The Distance Education and Training Council

     


    Copyright © 2002 Distance Education and Training Council — All rights reserved.
    Site Updated 12/11/2002
    Site maintained b
    y Sensiblenet
    Web Design by Sessions.edu

     

     

     

     

    159

    Ed-X: Online Education and Distance Learning Search Engine
     
    saturday | 12.14.2002
     
     
     

      Transportation Companies use eLearning for Regulatory Training
    click here

     
       • Ed-X Profile: Distance Learning 101 - Tips for Learning Online
    click here

     
       • Lincoln Tech to Offer Online Vocational Programs
    click here

     
       • MIT Launches Free "OpenCourseWare" with Online Class Summaries
    click here

     

    Ed-X.Com is a search engine and web resource for distance learning and online education with comprehensive information on over 20,000 online courses and degree programs from 700 online colleges worldwide. Use the Ed-X online education index below to locate online college courses or distance learning certificate and degree programs.

      Arts & Design
    Aviation
    Biology
    Business
    Computer Science
    Culinary Arts
    Education
    English
    Engineering
    Environmental Science
    Health & Nutrition
    Humanities & Liberal Arts
    Languages
    Law
    Math
    Medicine & Nursing
    Military Science
    Performing Arts
    Physical Sciences
    Political Science
    Psychology/Religion
    Other Subjects

    Degree Programs
    Certificate Programs
    Continuing Education
     • Credit (CLE, CPE)
     • Non-Credit
    Test Preparation

    If you cannot find an online degree or distance learning course using the Ed-X online education index, try using the site
    search engine to locate online degree programs, online college courses, and opportunities in online education.

    Universities: Ed-X offers cost-effective solutions to market your online education or distance learning program to a global student audience.
    Click here for more information on Ed-X Marketing Programs.

      Issues of Usability in Web Site & Software Design
    by Syracuse University (New York, USA)
    click here

     
       • From Demo to Deal
    by InsideSessions (California, USA)
    click here

     
       • Internet Applications for Benefit Plans
    by ERI Distance Learning Center (Washington USA)
    click here

     
     
     

     

       

     

     
       
     
     

    Copyright 1998-2002, Ed-X, LLC. All rights reserved.
    To review the Ed-X.Com Privacy Policy, click here.
    Copyright information and legal disclaimers.



    160

    Distance Learning Resource Network -- Star Schools

    disclaimer
    comments?
    The Technology Evaluation Sourcebook is now available.


    Take our survey!!

    Office of Educational
    Research & Improvement
    copyright 2000 DLRN

    161

    EDUCAUSE Home Page




    Net@EDUAN-MSI







    New ECAR Research Bulletin: Being Prepared for Technology Snow Days
    New Current Issues Resources: PDAs and Return on Investment
    State Education Networks Working Group
    EDUCAUSE/Forum for the Future of Higher Education Resources
    New Resources on HIPAA, National Cybersecurity Strategy, and SEVIS
    Mid-Atlantic Regional Conference (January 15–17)
    Gathering of State Networks (February 5–6)
    Base CAMP (Campus Architectural Middleware Planning) (February 5–7)
    EDUCAUSE Institute Management Program (February 9–13)
    Southwest Regional Conference (February 19–21)
    NERCOMP (March 16–18)
    Midwest Regional Conference (March 24–26)
    Networking 2003 (April 30–May 1)

    Bestselling Portals Book Now in PDF
    Explore the new PDF version of Web Portals and Higher Education, a book by some of higher education's top leaders on technology issues related to portals and their implications for the culture, business, organization, and policy environment of colleges and universities.

    EDUCAUSE 2003 Proposals
    EDUCAUSE 2003 preconference seminar proposals are due December 31. Don't miss this opportunity—submit a preconference seminar proposal now! Interested in presenting a conference session? Submit a conference proposal by February 17.

    Attend NLII Annual Meeting
    Explore emerging issues surrounding the role of technology in transforming teaching and learning at the 2003 NLII Annual Meeting, January 26–28 in New Orleans. New this year: sign up for EDUCAUSE virtual communities of practice prior to the meeting.

    Register for NERCOMP
    If you are in higher education IT and from the Northeast, you will find great value in NERCOMP, a conference that offers you useful, region-specific information and ideas and the opportunity to meet others in your field and from your region. Save money—register and make hotel reservations by February 21.

    EPS Promotion Ends 12/31
    End the year in a good way: Share a successful campus IT practice or solution by contributing to the Effective Practices and Solutions (EPS) database by December 31 and you will receive a Leadership Strategies book and be placed in a drawing for a free 2003 EDUCAUSE conference registration. Check out new EPS solutions in the database.

    Deadlines Approaching

    In looking at these costs and thinking about strategic planning for e-learning, it becomes clear that serving students on or off a campus with electronically mediated resources involves much more than just putting course material and support online.

    Click here for the source!
      Web Survey | Comments | Search | Copyright

    EDUCAUSE Offices
    1150 18th Street, NW, Suite 1010
    Washington, DC 20036
    202-872-4200 / 202-872-4318 (fax)
    4772 Walnut Street, Suite 206
    Boulder, CO 80301-2538
    303-449-4430 / 303-440-0461 (fax)

    For information about EDUCAUSE and its services, contact: info@educause.edu
    162

    Official Homepage of IACET

     

    "To promote and enhance quality in continuing education and training
    through research, education, standard setting, and certification."

    ENTER163

    Distance Learning Course Finder

     

    North American Associations

    CANADA

    Digital Education Network (actDEN)
    http://www.actden.com/

    Alberta Distance Education & Training Association (ADETA)
    http://www.athabascau.ca/html/collab/adeta/

    Association of Canadian Community Colleges (ACCC)
    http://www.accc.ca/

    Association for Media & Technology in Education in Canada (AMTEC)
    http://www.amtec.ca/

    Athabasca University
    http://www.athabascau.ca/

    Canadian Association for Distance Education Association Canadienne De L'education a Distance
    http://www.cade-aced.ca/

    Canadian Education Association Association Canadienne D'education
    http://www.acea.ca/

    Canadian Virtual University
    http://www.cvu-uvc.ca/

    Centre Collegial de Formation a Distance
    http://ccfd.crosemont.qc.ca/

    Centre for Distance Education - University of Ottawa
    http://www.distance.uottawa.ca/

    Commonwealth of Learning (COL)
    http://www.col.org

    Forum for International Trade Training (FITT)
    http://www.fitt.ca/

    Independent Learning Centre
    http://ilc.edu.gov.on.ca/

    Knowledge Connection Corporation
    http://www.kcc.ca/

    National College
    http://www.nationalcollege.ca/

    Office of Learning Technologies (OLT)
    http://olt-bta.hrdc-drhc.gc.ca/

    Open Learning Agency - Canada (OLAC)
    http://www.ola.bc.ca/

    Open Learning Information Network (OLIN)
    http://www.olin.nf.ca/

    Saskatchewan Communications Network
    http://www.scn.sk.ca/

    Simon Fraser University - Centre for Distance Learning
    http://www.sfu.ca/cde/

    Société de formation à distance des commissions scolaires du Québec (SOFAD)
    http://www.sofad.qc.ca/

    Teach Me Online
    http://www.teachmeonline.com/

    University of British Columbia - Distance Education & Technology
    http://det.cstudies.ubc.ca/

    University of Manitoba - Distance Education
    http://www.umanitoba.ca/faculties/con_ed/de/index.shtml

    University of Toronto - School of Continuing Studies
    http://learn.utoronto.ca

    University of Western Ontario - Distance Studies
    http://www.registrar.uwo.ca/distance/

     

    USA

    America's Learning Exchange (ALX)
    http://www.alx.org/

    American Association for Collegiate Independent Study (AACIS)
    http://www.aacis.org

    American Association for Community Colleges (AACC)
    http://www.aacc.nche.edu

    American Association for Higher Education (AAHE)
    http://www.aahe.org/

    American Association of University Professors (AAUP)
    http://www.aaup.org/

    American Center for the Study of Distance Education (ACSDE)
    http://www.ed.psu.edu/ACSDE/

    American Distance Education Consortium (ADEC)
    http://www.adec.edu/

    Arizona Distance Learning Association (AZDLA)
    http://www.azdla.org/

    Association for Applied Interactive Multimedia (AAIM)
    http://www.aaim.org

    Association for Computing Machinery (ACM)
    http://www.acm.org/

    Association for Educational Communications & Technology (AECT)
    http://www.aect.org/

    Association for the Advancement of Computing in Education (AACE)
    http://www.aace.org/about.htm

    Coalition for Networked Information (CNI)
    http://www.cni.org/

    Computer Using Education, Inc. (CUE)
    http://www.cue.org/

    Connecticut Distance Learning Association (CTDLA)
    http://www.ctdla.org/

    Consortium of College & University Media Centers (CCUMC)
    http://www.indiana.edu/~ccumc/

    Distance Education and Training Council
    http://www.detc.org/

    Distance Learning Channel
    http://www.ed-x.com/

    Distance Learning Resource Network (DLRN)
    http://www.dlrn.org

    Educause
    http://www.educause.edu/

    Florida Distance Learning Association (FDLA)
    http://www.fdla.com/

    Gateway to Educational Materials (GEM)
    http://thegateway.org

    Global Alliance for Transnational Education (GATE)
    http://www.edugate.org/

    Independent Schools Association of Northern New England (ISANNE)
    http://www.isanne.org/

    IMS Global Learning Consortium
    http://www.imsproject.org

    Instructional Telecommunications Council (ITC)
    http://www.itcnetwork.org/

    International Association for Continuing Education & Training (IACET)
    http://www.iacet.org/

    International Internet Learning Association (IILA)
    http://www.iila.net/

    International Society for Technology in Education (ISTE)
    http://www.iste.org

    International Telecomputing Consortium
    http://www.itc.org

    Learning Resources Network (LERN)
    http://www.lern.org

    MASIE - Technology & Learning Thinktank
    http://www.masie.com/

    Missouri Distance Learning Association (MODLA)
    http://209.132.79.190/

    Oklahoma Distance Learning Association (ODLA)
    http://www.odla.org/

    Pan Pacific Distance Learning Association (PPDLA)
    http://www.hcc.hawaii.edu/~digmed/PPDLA/PPDLA.html

    Society for Applied Learning Technology (SALT)
    http://www.salt.org/

    Texas Distance Learning Association
    http://www.txdla.org

    The Education Coalition (TEC)
    http://www.tecweb.org/

    United States Distance Learning Association (USDLA)
    http://www.usdla.org/

    University Continuing Education Association (UCEA)
    http://www.nucea.edu/

    Western Interstate Commission for Higher Education (WICHE)
    http://www.wiche.edu/home1.htm

    World Association for Online Learning (WAOE)
    http://www.waoe.org/

     


     

    This site is best viewed with:   Internet Explorer  |   Opera
    Updated: 09/04/2002
    Copyright Notice  |  Disclaimer  |  Feedback  |  About Us Copyright © 1999 – 2002 International WHERE+HOW
    Technical design and implementation of this service by DSS GmbH

     

    164

    LERN- Learning Resources Network

    If you offer classes, courses, meetings, or training, you have found

    "Information That Works"

    Learning Resources Network (LERN),
    the leading training and consulting service in lifelong learning

    The LERN Club



    TeachingOntheNet
    About the LERN Club
    Annual Convention
    Online Conference
    Online Courses
    Calendar
    CPP Information
    On-site Training
    Institutes
    Mall of Learning
    LERN Bookstore
    LLMS
    Membership
    Master's Degree
    About LERN
    Leadership
    Staff

    How to Contact us:

    tel: (800) 678-5376
    fax: (888) 234-8633
    e-mail: info@lern.org

    LERN
    P.O. Box 9
    River Falls, WI 54022

    What's New for December 2002

    Top Stories of the Year 2002

    The top story of 2002 is the announcement by the lifelong learning program at the University of Western Australia that it would go virtual. This is the first program in the world to start to become a virtual lifelong learning program.
    The top story last year was the decline in registrations that resulted from 9-11 and the response of lifelong learning programs to this issue.

    The top three stories for 2002:
    1. First lifelong learning program to go virtual.
    2. Economic recession leads to the worse downturn in registrations for lifelong learning programs in twenty years.
    3. The decline in computer enrollments marks a shift in generations participating in lifelong learning.

    Annual Convention
    Big success

    Once again, the LERN Annual Convention in Orlando this month proved to be “the most exciting week of the year in lifelong learning.”

    Around 800 people from 8 countries attended.

    Mark your calendar now for next year’s conference: San Antonio, Texas, December 4-6, 2003. Right on the famous riverwalk, we’ll celebrate LERN’s 30th anniversary.

    Email 3 colleagues

    When LERN membership grows, your services and benefits increase. Email 3 colleagues and tell them to join LERN. They will benefit, and so will you.

    LERN membership has increased 20% over two years ago, and is now at a record level.

    Lean on LERN

    Having tough times? Lean on LERN. We can help your program with the best information and consulting in the world.

    If you are a member, it’s FREE! Call Nancy or Tammy now at 1-800-678-LERN.

    EON Presentation

    The EON powerpoint Presentation, presented by Julia King-Tamang can be downloaded here.

    Coming next month!
    The 30 Most Profitable Things to Do

    Every month during the year 2003, the LERN Club will feature four of the 30 Most Profitable Things to Do.

    Visit your LERN Club every month. Each one of these techniques is worth thousands of dollars to your program.

    Magazine now online

    Your LERN Magazine is now online in the LERN Club. You can access past issues at any time.

    Members tell us that not all of their staff get to see the magazine every month because a couple of staff usually keep it. Here's the answer!

    Just tell your staff to go to the LERN Club and check out the LERN Magazine.

    Thomas elected to Board

    The first person from a governmental agency has been elected to the LERN Board of Directors.
    Percy Thomas, head of training for the National Weather Service in Silver Spring, Maryland, has been elected to the LERN Board of Directors.

    Thomas has been a long time member and LERN leader. Congratulations Percy.

    Call for Online Sessions

    Teaching OntheNet 2003, our annual conference on online learning and teaching, will be held on the Internet this year.

    The conference will feature audio presentations, slides, and ongoing discussion sessions.

    The online conference will be June 24-26, 2003. If you want to present an online session, simply send a two sentence description of your topic to Wm. Draves at draves@lern.org.

    We're coming to you

    With cutbacks in travel budgets for our members, LERN is coming to your area of the country.
    A new seminar, "Coming Out of Tough Times," is being held in more than ten states and provinces this spring.

    For information on the nearest one day seminar to you, email Nancy at nancy@lern.org

    Our top notch customer service team is ready to talk with you. Just click above to chat with Tammy Smith.

     

    SPECIAL OFFER!

    Successful Certificate Programs Manual

    Half Price!
    Now only $75.00!

    Order this manual today and increase your program's income!


    165

    USDLA | Home

     


     


    .166

    Google Search: "university continuing education assocation"

       
    Advanced Search    Preferences    Language Tools    Search Tips 
     Web 
     Images 
     Groups 
     Directory 
     News-New! 
    Searched the web for "university continuing education assocation" Results 1 - 5 of 5. Search took 0.07 seconds.
    Try Google Answers to get help from expert researchers.

    Continuing Education - Search PlanetEdu's Worldwide Education Directory
    www.PlanetEdu.com      Get there from here
    Sponsored Link
    New York University School of Continuing and Professional Studies
    scps.nyu.edu      Over 2,000 courses, professional certificates, and degree programs.
    Sponsored Link

    Sponsored Links
    CEU.com
    State-Approved Insurance CE online
    Full Money-Back Guarantee; from $19
    www.CEU.com
    Interest:
    See your message here...

    Award Winning New Identity for Columbia University Continuing ...
    ... The competition was sponsored by the University Continuing Education Assocation
    (UCEA), and awards were presented at UCEA’s 87th Annual Conference, held on ...
    www.prweb.com/releases/2002/8/prweb43207.php - 10k - Cached - Similar pages

    "Trigon" Faculty Development Program
    ... Quarter class. "Trigon" Faculty Development Program Honored by National
    University Continuing Education Assocation. The University ...
    www.gactr.uga.edu/gcq/gcqsum96/trigon.html - 5k - Cached - Similar pages

    Antioch University McGregor -- Faculty Pages -- Terry O'Banion - ...
    ... (Awarded the 1998 Philip E. Frandson Award for Literature in the Field of Continuing
    Higher Education by the University Continuing Education Assocation. ...
    www.mcgregor.edu/faculty/tobanion/topubs.html - 50k - Cached - Similar pages

    Terry O
    ... (Awarded the 1998 Philip E. Frandson Award for Literature in the Field of Continuing
    Higher Education by the University Continuing Education Assocation.). ...
    www.league.org/terry/default.htm - 101k - Cached - Similar pages

    Training Department 3.3 Create an Interactive Study Guide
    ... Each year the Independent Study Division of the National University Continuing Education
    Assocation (NUCEA) conducts a national competition for study guides. ...
    thor.cl.uh.edu/Course_Docs/DISTED/ Training/ct33/contnt23.htm - 5k - Cached - Similar pages




    Dissatisfied with your search results? Help us improve.


    Google Home - Advertise with Us - Search Solutions - Services & Tools - Jobs, Press, & Help

    ©2002 Google
    167

    WAOE Home (html)


    Home | Membership | Communication | Projects | Organization

    MALAY HINDI SPANISH GERMAN JAPANESE FRENCH
    PORTUGUESE CHINESE ESTONIAN RUSSIAN ITALIAN


    WAOE: Combining dedication to online learning with fun and cultural exchange.
    Become a WAOE Member.
    For WAOE Members

    WEB: WAOE Electronic Bulletin

    WAOE WebBoard: password required. Send inquiries to the WAOE Cyber-Parliamentarian


    Discussion

    All concerned with online education are welcome to join the discussion list WAOE-VIEWS. Just send email to imailsrv@list.waoe.org containing the following message:

    subscribe views<firstname><lastname>


    What Time Is It?

    Local Times Around the World

    Find out the time in GMT and other time zones for real-time online events.

    Announcements

    The 2002 Annual Board of Directors Meeting began asynchronously July 5, 2002. Most of these proceedings can be viewed by interested members at the WAOE WebBoard.


    The 2002 Annual Members' Meeting met its quorum of participants and elected three new WAOE Officers/ Directors:

    Vice President Rafael Molina-Velazquez,

    Executive Secretary Jenna Seehafer,

    Membership Chair Arun Kumar Tripathi

     

    Who We Are

         The World Association for Online Education (WAOE, pronounced "wowee,") is an international professional organization concerned with online pedagogy, registered as a nonprofit public benefit corporation (NPO) in the California state capital. WAOE offers membership services relevant to educators concerned with teaching online, public services for international society, and collaboration with other educational organizations functioning in cyberspace.

         At this Website please discover our organization and activities, how to join or participate in turning online education into a new professional discipline.

     

    Featured Affiliate in Tokyo:

         Visit the interactive Child Research Net (CRN) in a culture that highly values children and their education. The CRN English Website offers insight into Japanese culture and children, bringing together educators, professionals, researchers, and those concerned about the future well-being of children.

         Scroll through educational data, surveys, statistics, professional articles and essays by Japanese young people. Key issues are children in relation to society, media, education and lifestyle. There is a teacher's corner, a searchable Cybrary, and Asian educational links.

          Child Research Net (CRN) is a nonprofit branch of Benesse Corporation in Tokyo, a leader in correspondence education. A free weekly newsletter is available by e-mail, with feedback and discussion welcome at the "Let's Talk" Bulletin Board.


    New and Updated WAOE Websites

    WAOE President (Steve McCarty)

    Online Conferences (Keiko Schneider)

    WAOE Spanish Chapter site using Flash
    (Rafael Molina-Velazquez)

    WAOE Malay Chapter
    for Malaysia, Brunei & Indonesia
    (Ms. Begum Ibrahim)

     

    World Association For Online Education Supportive Affiliates:

    Estonia

    USA

    Japan
    Spanish

    Malaysia

    NonCreditEd.Net

    Spanish Language Chapter of WAOE

    Malay Language Chapter of WAOE

    Continue to: Membership | Communication | Projects | Organization

     ©1998-2002, e-mail World Association for Online Education

    Last update: 29 June 2002 by JS168

    Other Websites

    Brainbench - The Measure of Achievement

    Have a SkillsBench access code but haven't logged in yet? Click here169

    Welcome to CEU4U

    How does CEU4U work? 
    1.Sign Up 2.Choose Courses 3.Read or Print 4.Grade 5.Evaluate 6.Print Certificate
    170

    Welcome to CyberU - It's a new day, learn something.

    Copyright © 2000-2002 CyberU Inc. All rights reserved.  171

    entrinsik Inc. - Event Management Software

    Corporate
    entrinsik, inc.
    Managing Continuing Education: Applying SEMtek to the University of Alabama.
     
    Announcing Informer 1.1 - A Web based reporting tool that makes your data more valuable.
     
    Human Capital Management Software and Pharmaceutical Compliance spun off to Noverant. press release...
     
    Announcing: Informer  Coming Soon 
      Advanced Web Reporting     Web Based Event Management  
    172

    Welcome to Jacksonville University, a private, independent, liberal arts university on Florida's Atlantic coast.

    Jacksonville University • 2800 University Boulevard North • Jacksonville, Florida 32211 • 904-256-8000173

    MindLeaders: e-Learning that works.

    Copyright © 2002 MindLeaders. All rights reserved.
    174

    Quest Education

    175

    Regis University

    Search   |  Site Map   |  WebAdvisor   |  INsite   |  Common Questions   |  Directories   |  Contacts
    Prospective Students   |  Current Students   |  Alumni   |  Faculty & Staff
    176

    Saint Leo University

     

    Program Combines Liberal Arts and Business Studies

    Dr. Kirk Selected to NCAA Division II Presidents Council

    Saint Leo Partners with Nova Southeastern for Medical and Dental School

    Keep Up With the Lions - Student Activities Calendar

    More News....
    A Leading Catholic Teaching University of International Consequence
    33701 State Road 52 Saint Leo, FL 33574-6665
    Search SLUCurrent StudentsAlumni and FriendsFuture StudentsFaculty and StaffAbout SLUGiving to SLUEmployment OpportunitiesLibrariesFacts and NewsAthleticsStudent AffairsOnline EducationLocationsAcademicsFinancial AidAdmission177

    THINQ :: Learning That Powers Business

     
    THINQ's enterprise learning management software powers the learning that powers business.
    THINQ helps organizations:


    THINQ and ADL join forces to tackle e-learning interoperability challenge
    3 December 2002

    Navy Personnel Command deploys THINQ LMS
    to make training administration ship shape

    4 November 2002

    Palm Beach County Sheriff's Office moves training onlinewith THINQ TrainingServer Learning Management System
    October 16, 2002

    To read more press releases, CLICK HERE.

    Learning Circuits - November 2002
    http://www.learningcircuits.org/2002/nov2002/harris.html

    WorkIndex.com - November 2002
    http://www.workindex.com/editorial/train/trn0211-s-01.asp

    To read more articles releases, CLICK HERE.

    Privacy and Security   ©2002 THINQ Learning Solutions, Inc.

    178

    8. Career Info, Advice, & Research Sites

    Welcome to America's Career InfoNet

       A Component of CareerOneStop
    Site Map | Help 
     
    Welcome to America's Career InfoNet!

    Smart career decisions start here! Find wages and employment trends, occupational requirements, state by state labor market conditions, millions of employer contacts nationwide, and the most extensive career resource library online.
    Career Information

    General Outlook
    General job market trends for different education levels.

    Wages and Trends
    Wage and occupational trends for your selected state and occupation.

    What it Takes
    Find important knowledge, skills, abilities, tasks and more for your selected occupation.

    State Information
    State demographic and economic information, as well as links to education, cultural and recreation resources.

    Customized Report
    We selected some of our most popular reports and combined them into an easy-to-use Customized Report.

    View detailed information about Emergency Medical Technicians and Paramedics, the featured occupation in our Career Spotlight.
    Did You Know ...
    We have links to the largest online nation-wide job bank (America's Job Bank).
    From actuaries to writers, we have career videos for nearly 300 occupations showing real people doing real work.
    Career Tools

    Employability Checkup
    Determine where you stand if you lost your job today.

    Licensed Occupations
    Find out about occupational licensing requirements.

    Employer Locator
    Learn about potential employers including contact information.

    Job Description Writer
    Write better job descriptions using the power of O*NET.

       Financial Aid Advisor
    Find resources to pay for training and learning.

    Career Exploration
    Navigate the CareerOneStop web site.

    Career Resource Library
    Nearly 5,500 links to online Career Resources.

    Reading Room
    Find articles and reports on career and workforce development.

       
     Find It By Topic  
     Employment Center
     Relocation Center
     Financial Aid Center
     Skills Center
     Business Center
     Training & Education
     Testing & Assessment
     Labor Market Info
     Career Tools
     Newsroom

    Toll-Free Help Line
     
    Call our Toll-Free Help Line for help with employment and training questions.

    1-877-US-2JOBS
    or
    TTY 1-877-889-5627
     
    About Us | Partners | Link To Us | Privacy | Feedback | Help
    179

    The Riley Guide: Employment Opportunities and Job Resources on the Internet

    The Riley Guide180

    Quintessential Careers: College, Careers, and Jobs Guide

    Get a New Job!
    Main Features:

    We have all the tools you need to succeed! Now with more than 1,500 pages of content to help you find the college, career, or job you want.
    Open Our Career Toolkit -- cover letters, resumes, networking, interviewing, salary negotiation, career tests and quizzes, and more career resources...
    Find a Job -- by job-seeker type, industry, and geography, as well as general job sites. More than 1,400 job sites and company career centers.
    Pursue an Education -- tips, links, and expert advice about undergraduate and graduate college degrees, financial aid, and distance learning.
    Locate the Perfect Book -- all the best books to help you in your job search and career development.
    Subscribe to Our E-zine -- a free, biweekly career and job newsletter filled with tips for springboarding your career.
    Get a New Resume -- or cover letter, curriculum vitae, or any job correspondence. Let the career experts help perfect your job-search!
    Visit Our Career e-Store -- where you can find the resources you need to help you achieve your career and job-search goals!
    Learn About This Site -- history, mission, overview, site map, honors and awards, and more...
    Ask the Career Doctor -- check out his diagnoses and prescriptions for all types of career, college, and job-search ailments.
    Engage a Career Speaker -- hire a job-search expert for your next career-related conference or workshop.
    Work with our Partner Sites -- a select group of the very best job, career, and college companies.
    Use the Employer Resources -- the best resources for employers.


    December 16, 2002

    What's Quintessential & Current

    Featured Article of the Week
    Are you preparing to leave your job? Learn How to Diplomatically Resign From Your Job.

    Career Tip of the Day
    What's the impact of a college degree for a "non-traditional" student? Read more.

    Career Tool of the Day
    Real Jobs. Real Grads. Real World.

    Great Holiday Career Gifts
    We have some great gift ideas for your favorite job-seeker or student -- including books, job-search packages, and online courses. Go to: Quintessential Careers Holiday Gift Ideas.

    Featured Career Site
    EssayEdge -- with more than 100 free sample college and graduate school application essays, this site is the Net's largest resource. EssayEdge can help you gain entrance into your first choice school. Free and fee-based.

    Using this Career and Job Portal
    If this is your first visit to Quintessential Careers, you may want to take a short tour of the many resources we offer. Take the tour. Or, you can view our portal page. Have a specific question? See if it's answered in our Facts About QuintCareers.com (FAQ). Finally, if you can't use the pull down menu below, here is a page that provides links to our key college, career, and job resources.

    And if you're not already a subscriber, please subscribe to our free career development and job-hunting e-newsletter, QuintZine, for all our new developments and additions. Finally, take a look at our latest additions.

    Search Quintessential Careers
    Looking for something in particular related to careers, jobs, or college? Search our site.




    Quintessential Careers -- DeLand, FL 32720
    Home Page: http://www.quintcareers.com/
    Email: randall@quintcareers.com
    Copyright © Quintessential Careers. All Rights Reserved

    181

    Vault: the insider career network


    New 2003 Vault guides available now!



    Check out Vault's new Career Guides to Investment Management, Consulting, Media & Entertainment, and Accounting. Also, see our profiles for Goldman, Morgan Stanley, McKinsey, BCG, Coke, BearingPoint and many others. Check them out! Vault Gold members get a 15 percent discount on all Vault guides, and much more!182

    WetFeet.com > Helping You Make Smarter Career Decisions

    Companies
    Careers & Industries
    Newsletters
    Salary & Perks
    City Profiles
    International
    Insider Guides
    Self-assessment
    Resumes
    Interviewing
    Managing Your Career
    Internships
    Diversity
    Discussion Boards
    Career Changers
    MBAs
    Undergrads
    Job Listings
    Internship Listings

    Welcome.   Login or Join
    The WetFeet Store
    Careers in Accounting
    IBM Business Consulting Services
    Jumpstart Your Career: Find and Leverage Your Ideal Internship
    Free Shipping!
    Partner Spotlight

    In the news

    Home >
    Do Research
    Even more updated insider information to help you land the job.

    Deloitte Consulting (Soon to be Braxton): The WetFeet Insider Guide
    McKinsey & Company: The WetFeet Insider Guide
    Careers in Investment Banking
    Careers in Venture Capital
    Investment Banking Interviews: Beat the Street

    View All 2002/2003 Insider Guides

    Featured Company

    Shell Oil Company
    Read The Expanded Company Profile
    Career, Industries & Companies
    Find out salaries, job requirements, and more, for industries and careers.

    Industry Profiles
    Career Profiles
    Company Profiles
     
    Get Advice
    From the experts at WetFeet.
    Featured Articles
    Avoiding Office E-Mail Gaffes
    Can your e-mail use land you in hot water?
    Read More


    Expert Advice
    Resumes
    Interviewing
    Internships
    Diversity

    Just for You
    Career Changers
    MBA's
    Undergrads

    Career News
    WebLog: Career news of note from across the Web.

    Find a Job
     
    Find an Internship
    View thousands of listings from across the USA.
    Powered by InternshipPrograms.com


    Search Internships by:
    Company
    Career Category
    US City & State

    © 2002 WetFeet, Inc.     Legal | Privacy | Careers@Wetfeet | Help | Contact Us | For Career Centers
    183

    WinningtheJob.com

    HomeFeatured booksWhat's new at Impact Publicationslook for these career booksOrder from our catalogs today!
    Cover Letters
    Interviewing
    Networking
    Resumes
    Salary Negotiations
    Internet Job Search
    Image & Etiquette
    Attitude & Motivation
    Self-Assessment
    Career Development
    Presentation Skills
    Networking
    Empowerment
    Anger & Conflict
    Advertising
    Affiliate Program
    Special Sales
    Dealers
    Catalogs
    Who We Are
    Contact
    Privacy Policy
    Impact Publications
    Veterans World
    iShopAroundtheWorld
    ContentforCareers
    ContentforTravel

    Featured Tips:

    Salary Negotiation Do's and Don'ts

    1.Develop the proper frame of mind. 2.Integrate career and negotiation goals. 3.Know your market value. 4.Develop a negotiating strategy. 5.Recognize the employer's position as well as your own.

    Do You Talk Too Much During Interviews?

    Interviewers often eliminate a candidate from consideration because he or she "talked too much" during the job interview. Indeed, excessive talkers irritate potential employers. The silent types often have a major advantage in job interview situations, and especially if they know how to use silence to their financial advantage!

    Cover Letters
    Interviewing
    Networking
    Resumes
    Salary Negotiations
    Internet Job Search
    Dress & Image
    Attitude & Motivation
    Self-Assessment
    Career Development
    Presentation Skills
    Networking
    Empowerment
    Anger & Conflict
    Executives
    Government
    International
    Military
    Special Needs
    Students
    Women
    College Financing
    College Majors/Jobs
    College Selection
    College Testing
    School to Work
    Study Abroad
    Study & Test Skills
    Copyright 2001, Impact Publications All rights reserved.
    184

    CEOExpress: Business portal for executives created by a CEO


     

    Monday, December 16th 

    Tell a friend! | Make CEOX My Home

    Email at Work
    Editor's Note: This report from the PEW Internet Research Center finds that email is an effective tool at work.
    Great Sites Archive
    News

    NY Times
    AP Wire
    Technology

    Business
    Sports
    Weather
    Services:  CEOExpress Intranets/Extranets | Real-Time Finance Center | Travel: FlightsHotelsCars | Domain Names
    Business Links: Daily News & Info

     Biz Research    Tools & Travel    Breaktime    ExecuDiva  | CEOX Toolbox | CEOX Mobile

    Daily News: Boston Globe | Chicago Tribune | Christian Science Monitor | Los Angeles Times | New York Post | New York Times | Newsday | San Jose Mercury News | USA Today | Washington Post | Major Metros | Other Newspapers | More...

    Business News: Barrons ($) | CNNmoney | Crain's: Chicago | Crain's: NY | Daily Deal | Financial Times | Investor's Business Daily | Journal of Commerce | Kiplinger | Law News Network | Singapore Business Times | Wall Street Journal ($) | U.S. Business Journals

    International News: Globe and Mail | Herald Tribune | Le Monde | London Times | Africa | Asia | Asia Pacific | Canada | Central America | Europe | Middle East | United Kingdom | South America | S. East Asia

    Online Television News: ABC | BBC | CBS | CNN | C-SPAN | Fox | MSNBC | PBS | CNBC

    Cell Phone Messaging: AT&T | Cellular One | Nextel | Sprint PCS | Verizon | More...

    Business Magazines: Business 2.0 | Business Week | CFO | Context | Darwin Magazine | Economist | Fast Company | Forbes | Fortune | Inc. | Newsweek | Red Herring | Smart Money | Time | US News | Wired | More...

    Business Knowledge: Harvard Business Online | Insead | Knowledge@Wharton | Strategy&Business | McKinseyQuarterly: Strategy | E-Commerce | Marketing | Operations | Finance | Technologies | WhitePapers: Technology White Papers

    Tech Magazines & News: AtNewYork | CIO | C-NET | ComputerWorld | First Monday | Intranet Journal | MIT TechReview | SlashDot | ZDNet | More...

    Lifestyle Magazines: American Demographics | Arts & Letters Daily | Atlantic Monthly | Golf Digest | Harper's Index | National Geographic | New Yorker | Salon | Scientific American | Slate | Magazine Database

    Time & Weather: Airport Delays | Biz Travel Advisories | Forecasts: Intellicast | Nat'l Buoy Center | Weather Channel | Weather Images | Yahoo | Time: Naval Clock | Perpetual Calendar | U.S. Time | World Time Zones

    Track Packages: Airborne | DHL | Emery | Express Mail | FedEx | UPS

    Newsfeeds: AP Wire | AP Sports | Bloomberg | Politics | Drudge Report | NPR | Reuters | UPI | VentureWire | PressReleases: Business Wire | PR Newswire | International: AP Wire Int'l | Canada Newswire | More...

    Internet Search: Express Search | Web Directory | About.com | Alta Vista | Ask Jeeves | Excite | Google! | Northern Light | Teoma | Wall Street Search | Yahoo | Lists: Fortune 500 | Global 500 | Private 500 | Inc. 500 | The List of Lists | Search Help: Invisible Web | How best to use a search engine | Search Strategy | More...

    Website Locator: Domain Registration | InterNIC 'Whois' | Register.com

    Health: Allergy Forecasts | Alternative Medicine | Ask Dr. Weil | Drug Index | Healthfinder Search | Mayo Clinic | Medscape | Merck Medicus | Nat'l Library of Medicine | Poison Centers | Product Recall Database | Quackery & Fraud | WebMD | Cancer Resources: American Cancer Society | Cancer Network | OncoLink | Physician Search: DocFinder | State Medical Board Search | Who's Board Certified? | More...

    Industry CenterResearch TipsCEO@HomeAsk an Expert!10 QuestionsExcudiva

    Financial Markets: AMEX | Averages & Composites | Nasdaq | Nikkei | NYSE | Commodities Charts (T-bills etc.) | Futures Quotes | Foreign Exchange | Int'l Stock Exchanges | Analysis: Bureau of Economic Analysis | Dismal Scientist | More...

    SEC: Edgar Scan | SEC Database | Edgar Online People | FreeEdgar | NAICS/SIC Codes | SEC News Digest | SEC Document Primer | More...

    Government Agencies: Gov't Printing Office | Gvt.Research Services | IRS | OSHA | US Patents | US Trademarks | All Government Agencies | Int'l Agencies: Foreign Gov't Resources | IMF | World Bank | State Agencies: State Resource Center | More...

    Statistics: Bureau of Labor Stats | Cyber Atlas | Fedstats | Int'l Stats | Population Lookup | U.S. Statistical Abstract | Umich Documents Center | US Census Datamaps | U.K. Statistics | Regional Data | More...

    Internet Research & Surveys: eLab | Electronic Commerce Guide | Internet Business Surveys | WWW User Survey

    Legislature: 2003 Federal Budget | Federal Register | Legislator Search Engine | State Legislatures | Thomas Legislative Search | US House | Email | US Senate | Email

    Business Links: Financial Data Finder | FinWeb | IOMA Business Directory | Research Links

    Quotes and Market News: BigCharts | CBS Marketwatch | Earnings Surprises | Money Central | Quicken | Upgrades & Downgrades | Yahoo Finance | StockScreener: Yahoo | Int'l: Canadian Companies | F T MarketWatch | World Portfolio | More...

    Online Investor Services: Ameritrade | Datek | E*Trade | Fidelity | Harris Direct | Schwab | TD Waterhouse | Morgan Stanley Online | Merrill Lynch

    Banking & Finance: Personal Finance Resources | Bank Rate Monitor | Banks of the World | Federal Reserve | Finance Student's Web World | Research: Merrill Lynch | UBS Paine Webber | Wright Research Center | Venture Capital: Venture Firms | More...

    Small Business: SOHO Resources | AmEx Small Biz Exchange | BPlans.com | Business Forms | Business Toolkit | Chambers of Commerce | EntreWorld | Government Resources | SBA | Small Business State Profiles | Yahoo Small Business | Taxes: IRS Small Business | Tax Checklist | More...

    Law: ABA LawLink | CataLaw | FindLaw | Intellectual Property | Lawyer Locator | West Directory | Federal/State Code: Code of Federal Regulations | State Code & Cases | Tax Code | U.S. Code | SEC: SEC Law.com | Securities Class Action Clearinghouse

    Online Marketing: Ad Media | ClickZ Network | Metrics: Media Metrix | Nielsen Ratings

    Company Research: Industry Specific Research | Annual Reports | Brint Research | Corporate Info | Corporate Library | Hoover's | Patents Search | Tech Company Search | Thomas Register | Thomas Regional Directory | Wall Street Research | Associations: Professional | Trade | Web Directory | Ratings: A.M. Best | Moody's | Standard & Poor's | Online Research Tips: Citing Sources | Researching Companies | More...

    International Business: Global Business Centre | Int'l Business Resources | Int'l Stats | Market Research | WorldSkip | Wrights Research Center | By Country: Asia | Blue Book of Canadian Business | Canadian Industry Research | Canadian Securities Admin. | Euro Pages | European Manufacturers | Hoovers Int'l: UK | DE | ES | FR | IT | More...

    Investing & IPO Research: MSN Investor | Morningstar | Motley Fool | The Street | Silicon Investor | Raging Bull | IPOs: IPO.com | IPO Unlockdates | IPO Maven | Superstar Investor | Earnings Whispers: Whisper Numbers | Upcoming Analyst Calls | Regulation: NASD | More...

    Bankruptcy: American Bankruptcy Institute | Bankruptcy Stats | Internet Bankruptcy Library

    Cutting Edge: ATT Research Lab | BotSpot | Gamelan (Java Applets) | MIT Media Lab | NECI Scientific Digital Library

    Industry CenterResearch TipsCEO@HomeAsk an Expert!10 QuestionsExcudiva

    Office Tools: Anonymizer | Calculators Online | Currency Calculator | Postage Calculator | Salary Calculator | Skytel | Maps: MapQuest | Subway Navigator | Tax Info: IRS Forms: Federal | IRS Forms: State | More...

    Speech & Writing: Citing Sources | Common English Errors | Elements of Style | Guide to Grammar & Writing | PresentationTips | Press Release Guide | Famous Quotes: Bartlett's Quotations | QuoteLand | More...

    Reference: Britannica | CIA World Facts | Consumer Info Center | Encyclopedia.com | Fast Facts | RefDesk | Translation Site | Dictionaries: "One Look" | Multi-Lingual | Thesaurus | Webster's Dictionary | Libraries: Internet Public Library | Library of Congress | National Archives | Misc: Homework Help | eHow | HowStuffWorks | Public Records Database | World Public Holidays | NewsResource Center | LibrarySpot | Technology Encyclopedia | More...

    Directory Search: AnyWho | Area Code Finder | Switchboard | Int'l Dialing Codes | 800 Directory | Yellow Pages | Zip Code Finder | Zip Code Finder (Business)

    Essential Downloads: Acrobat Reader | Download.com | Kid's Software | Shockwave | Software Library | TUCOWS | WinZip | AntiVirus: McAfee | Norton | Browsers: Internet Explorer | Netscape | Opera | Security: Microsoft Security Patches | VirusAlerts | More...

    Tech Tools: Computerworld Quickstudy | Internet Traffic Report | List of ISPs | NetMechanic | PhotoFinder | Website Design Advice: Ask Tog | Alertbox | Standards: World Wide Web Consortium

    Airlines: Airlines (World Wide) | Airline Phone #s | Airport Directory | Flight Arrivals and Departures | Schedules: America West | American Airlines | Continental | Delta | Jet Blue | Midwest Express | Northwest | Southwest | United | US Airways | Flight Information: Airline Safety | Airline Seat Maps | Airport Delays | Real Time Flight Tracker | More...

    Travel: Express Travel Center | Ticketing: Expedia | Orbitz | Travelocity | Discount Travel: Priceline | Site59 | General: AAA | AmEx Travel | BizTraveler | CNN City Guide | Fodors | Frommer's | Concierge | Airplane Safety | International: Health Information | Legal Assistance | Passport Services | Travel Warnings | World Travel Guide | Driving: Driving Directions | Road Traffic & Construction | Trains: Amtrak | Subway Navigator | Accommodations: Bed and Breakfast | Find A Room | Hotel Directory | Small Luxury Hotels | More...

    Industry CenterResearch TipsCEO@HomeAsk an Expert!10 QuestionsExcudiva

    Sports: CBS Sportsline | ESPN | Fly Fishing | Golf Course Locator | Golf Search | Maritime Links | MySportsGuru | Sports Illustrated | NFL.com | More...

    Real Estate: HomeAdvisor | Nat'l Real Estate Investor | Realtor.com | Relocation: Monster Moving | School Locator | More...

    Leisure: Citysearch | Epicurious | Movie Reviews | Movie Showtimes | Playbill | Ticketmaster | Way Back Machine | Zagat Dine | More...

    Unwind: Bartleby Library | Blue Mountain Arts | Civil War Archives | Dave Barry | Dilbert Zone | History Channel | LyricServer | Periodic Table of Elements | Project Gutenberg | Skeptic's Dictionary | Top Ten Lists | TV Listings | More...

    Autos: Autobytel.com | Car & Driver | Carpoint | Edmunds Auto Info | Hemmings | Intellichoice | Kelley Blue Book | Yahoo Automotive | Safety: Automotive Recalls | Car Safety Ratings | Lemon Laws

    Shopping: Express Biz Shopper | Express Personal Shopper | Books: Amazon | Barnes & Noble | Powell's Books | Rare & Used Books: Alibris | Computers/Software: Dell | Gourmet Food, Flowers & Gifts: 1-800-Flowers | GiftCorp | Great Posters | Hallmark | zChocolat | Music/Movies/Tickets: Amazon | CDNow | Sold-Out Tickets

    Learn more about upgrading to CEOExpressSelectsm: Take a Peek | Upgrade Now

    Business Office: 470 Atlantic Ave, 4th Floor, Boston, MA 02210 | voice - (617) 482-1200 | fax - (617) 273-8033
    ©1999-2002 CEOExpress Company     Boston     webmaster@ceoexpressmail.com
    Copyright & Disclaimer | Privacy Policy | Terms & Conditions | About the Company | Advertise | Contact Us | Link to Us
    Preferred Partners
    Preferred Partners
     Intranets/Extranets
     Intranets/Extranets
     Express Destinations
     Express Destinations
     CEO@Home
     CEO@Home
     Business Research
     Business Research
     Help/Contact
     Help/Contact
     Web Conferencing
     Web Conferencing
     Ask An Expert
     Ask An Expert
     Amazon.com
     Amazon.com
     Expedia
     Expedia
     Travel Center
     Travel Center
     Great Posters
     Great Posters
     Sold-Out Tickets
     Sold-Out Tickets
     Real Time Quotes
     Real Time Quotes
     Intranet Solutions  
     Intranet Solutions  
     Custom Libraries  
     Custom Libraries  
     Customer Facing Portals  
     Customer Facing Portals  
     JournalistExpress
     JournalistExpress
     LawyerExpress
     LawyerExpress
     LogisticsExpress
     LogisticsExpress
     MDExpress
     MDExpress
     PDA Site 
     PDA Site 
     WAP Site     
     WAP Site     
     Biz Shopper
     Biz Shopper
     Personal Shopper
     Personal Shopper
     Bookshop
     Bookshop
     Homework Help :)
     Homework Help :)
     Your Health
     Your Health
     Sports
     Sports
     Living Arts
     Living Arts
     Personal Finance
     Personal Finance
     Career Center
     Career Center